Basic information Structure Safety Related Supplier

ChemicalBook Product Catalog Organic Chemistry Phosphines LL-37

1/1

LL-37 NEW

$0.00 1KG

$0.00 5KG

$0.00 10KG

Min. Order1KG
Purity99%
Cas No154947-66-7
Supply Ability1T
Update time2025-10-22

Shandong Hanjiang Chemical Co., Ltd

Shandong Hanjiang Chemical Co., Ltd

VIP2Y

China

China

show more

Enterprise Verified

Business Bank account Basic Contact Infomation Business Address Trade Company

Chemical Properties

Product Name	LL-37
CAS No	154947-66-7
EC-No
Min. Order	1KG
Purity	99%
Supply Ability	1T
Release date	2025/10/22

Product Name:	LL-37
Synonyms:	Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS:	154947-66-7
MF:	C205H340N60O53
MW:	0
EINECS:	211-519-9
Product Categories:
Mol File:	Mol File

LL-37 Chemical Properties

solubility	Water: 1 mg/ml
form	A lyophilized powder
color	White to off-white
Water Solubility	Soluble to 1 mg/ml in water
Sequence	Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
InChIKey	POIUWJQBRNEFGX-XAMSXPGMSA-N

Safety Information

MSDS Information

LL-37 Usage And Synthesis

Structure	The structure of LL-37 in SDS micelles is composed of a curved amphipathic helix-bend-helix motif spanning residues 2–31 followed by a disordered C-terminal tail. The helical bend is located between residues Gly-14 and Glu-16. Similar chemical shifts and 15N nuclear Overhauser effect (NOE) patterns of the peptide in complex with di octanoyl phosphatidylglycerol (D8PG) micelles indicate a similar structure. The aromatic rings of Phe-5, Phe-6, Phe-17, and Phe-27 of LL-37, as well as arginines, showed intermolecular NOE cross-peaks with D8PG, providing direct evidence for the association of the entire amphipathic helix with anionic lipid micelles. The structure of LL-37 serves as a model for understanding the structure and function relationship of homologous primate cathelicidins[5].
Description	LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
Uses	L 37 (human) is a 37 amino acid host defense peptide originating from the C-terminal of the human cathelicidin antimicrobial peptide (CAMP, hCAP18). This peptide possesses antimicrobial, antitumor, antiviral, and immunomodulatory properties, along with physiological functions in chemotaxis, wound healing, and angiogenesis. Beyond its antimicrobial capabilities, LL 37 (human) influences various pathways in autoimmune and inflammatory diseases, playing a role in the development of lupus, rheumatoid arthritis, and atherosclerosis. As a binding partner to Aβ42, the expression of LL 37 (human) affects the onset and progression of Alzheimer's disease. Additionally, LL 37 has a notable role in human cancer, promoting tumorigenic effects in ovarian, lung, breast, prostate, pancreatic cancers, and malignant melanoma.
Origin	Mammalian AMPs belong to the defensin and cathelicidin families. So far, there is a unique cathelicidin peptide found in 1995 and called human cationic antimicrobial peptide (hCAP18). Its active part starts with double leucine and consists of 37-amino acids at the C-terminus, so which is called LL-37.
benefits	LL-37 is an important part of the human immune system, which can resist various pathogens. A plethora of experiments have demonstrated that it has the multifunctional effects of immune regulation, in addition to antimicrobial activity. Significantly boosts immune function; Fights inflammation; Prevents cancer progression; Accelerates wound healing; Lowers the risk of heart disease; Prevents lung injury; Promotes bone repair.
Biological Activity	LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.
Side effects	LL-37 side effects are very uncommon. LL-37 induced apparent rosacea symptoms, erythema, and telangiectasia on the skin. Side effects associated with LL-37 may include the following: Increased inflammation Induction of autoimmune disease Depression Damage to sperm surface membranes
storage	Store at -20°C
References	[1]Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823 [2]Bandurska et al (2015) Unique features of human cathelicidin LL‐37. BioFactors 41 289 PMID: 26434733 [3]Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147 [4]Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL?37 in oral tongue dysplasia and carcinoma. Oncol. Rep. 44 325 PMID: 32627035 [5]Wang, Guangshun. “Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles.” The Journal of Biological Chemistry 283 47 (2008): 32637–43.

show more

Company Profile Introduction

You may like

Recommended supplier

$0.00/1Box

Shanghai Yimeixin Technology Co., LTD

VIP1Y

LL-37 （LL37)PEPTIDE

$30.00/1kit

Shenzhen Aoxi Technology Co., Ltd.

VIP1Y

$10.00/1box

Ningbo Qingteng Plastic Cost.,Ltd.

VIP1Y

$5.00/1BOX

Hebei Jiafan Trading Company Limited

VIP1Y

$20.00/1kg

Shaanxi Franta Biotechnology Co., Ltd

$0.00/1BOX

Shandong Huizhihan Supply Chain Co., Ltd

VIP2Y

$80.00/1Box

Qingdao Xinli Technology Development Co., Ltd.

$35.00/1box

Hebei Xinsheng New Material Technology Co., LTD.

$85.00/1box

Strong peptide cross-border e-commerce Co. LTD

$0.00/1Box

Shanghai Affida new material science and technology center

MSDS|CAS|CAS DataBase|Pricacy|Terms|About Us|New Products| Contact us|Computer Version
Chemical Book