Product Name: IGF LR3 1mg
Molecular Weight: 9117.60 gmol
Purity: ≥98%
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Form: Lyophilised Solid
Long arginine 3-IGF-1 (IGF-1 LR3), available in a 1mg quantity, is a premium research peptide designed for advanced scientific studies in biochemistry and related disciplines. This product is perfect for laboratory environments that require high levels of precision and reliability.
IGF-1 LR3 Storage and Usage
IGF-1 LR3 1mg comes in lyophilized form for optimal stability and convenient use in research settings.