1. Product information
Names
Name | Dulaglutide |
---|
Synonym | More Synonyms |
---|
Dulaglutide Biological Activity
Description | Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG. |
---|
Related Catalog | Signaling Pathways >> GPCR/G Protein >> Glucagon Receptor Research Areas >> Metabolic Disease Peptides |
---|
Target | GLP-1 receptor[1] |
---|
In Vivo | Dulaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist. No specific Dulaglutide-related cause of death is identified. Survival is numerically increased for both genders of animals in all Dulaglutide treatment groups and reaches statistical significance (P≤0.05) in the 0.5- and 5-mg/kg males and in the 0.05-, 0.5-, and 1.5-mg/kg females. Mean times to peak plasma concentration values of Dulaglutide are observed at 12 hours after dosing on day 1 and rang between 12 and 48 hours at week 52. The incidence of thyroid C-cell adenoma is significantly (P≤0.05) increased compare with controls in males and females at the Dulaglutide 0.5-, 1.5-, and 5-mg/kg doses[1]. |
---|
Animal Admin | The tumorigenic potential of Dulaglutide is evaluated in rats and transgenic mice. Rats are injected sc twice weekly for 93 weeks with Dulaglutide 0, 0.05, 0.5, 1.5, or 5 mg/kg corresponding to 0, 0.5, 7, 20, and 58 times, respectively. Transgenic mice are dosed sc twice weekly with Dulaglutide 0, 0.3, 1, or 3 mg/kg for 26 weeks[1]. |
---|
References | [1]. Byrd RA, et al. Chronic Toxicity and Carcinogenicity Studies of the Long-Acting GLP-1 Receptor AgonistDulaglutide in Rodents. Endocrinology. 2015 Jul;156(7):2417-28. |
---|
Chemical & Physical Properties
Density | 1.4±0.1 g/cm3 |
---|
Molecular Formula | C149H221N37O49 |
---|
Molecular Weight | 3314.62 |
---|
LogP | 3.81 |
---|
Index of Refraction | 1.706 |
---|
Storage condition | -20°C |
---|
2. Packaging
For powders: normal is 25kgs/Drum or bag, or larger/smaller package as request.
For liquids: normal 25kgs/drum, 180-300kgs/bucket, or IBC, determined by the nature of the product.
Or smaller package 1kg/bottle, 10kgs/bottle as request.
![](https://www.chemicalbook.com/ProductImageEN/2023-12-22/6383883388384104846238209.jpg)
![](https://www.chemicalbook.com/ProductImageEN/2023-12-22/6383883388640719519513792.jpg)
3. Shipping
![](https://www.chemicalbook.com/ProductImageEN/2023-12-21/6383876615165911184936047.jpg)
4. Contact information
For more details, pls contact us freely.
Mob: 86 17630971917
WhatsApp/Skype/Wechat/LINE: 86 17630971917