Common Name | Dulaglutide |
---|
CAS Number | 923950-08-7 | Molecular Weight | 3314.62 |
---|
Density | 1.4±0.1 g/cm3 | Boiling Point | N/A |
---|
Molecular Formula | C149H221N37O49 | Melting Point | N/A |
---|
MSDS | N/A | Flash Point | N/A |
---|
Use of Dulaglutide
Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.
1kg/aluminum foil bag or 25kg/drum
1.1kg-10kg packing: 2 P.E. bag inside + 1 foil bag outside
2. 15kg packing: 2 P.E. bag inside + 1 foil bag outside in carton
3. 25kg-50kg packing: 2 P.E. bag inside + 1 foil bag outside in drum
4. Customized packing
Shipping:
1) By Express: EMS/ DHL/ FedEx/ TNT/ UPS for sample or small order
2) By air or Sea for bulk order
Our Services
1) The professional sales reprensentative answers your inquiy on time;
2) We can provide reasonable price, high quality product and prompt shipmen;
3) We can send the goods to your delivery addreee directly, it is relatively safe and fast;
4) Warm sfter sale service, we will help to solve the problems in your usage.
whatsapp/signal/telegram;+8617621705551
wickr:luckymeng588