Product Description:
Product Name:Sermorelin
Synonyms: :SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
CAS NO:86168-78-7
Molecular Formula:C149H246N44O42S
Molecular Weight:3357.93
Density:1.45±0.1 g/cm3
Assay:≥98%
Grade:Pharmaceutical Grade
Appearance:White to off white powder
Storage:−20°C
Usage:Synthetic polypeptide, by promoting the release of growth hormone pituitary
Hot Sale Product List:
| CAS NO. | Product |
| 148553-50-8 | Pregabalin |
| 593-51-1 | Methylamine hydrochloride |
| 5086-74-8 | Tetramisole hydrochloride |
| 16595-80-5 | Levamisole Hydrochloride |
| 59-46-1 | Procaine |
| 1994/9/7 | Benzocaine |
| 11113-50-1 | Boric acid tablets |
| 1009-14-9 | valerophenone |
| 62-44-2 | Phenacetin |
| 5337-93-9 | 4-Methylpropiophenone |
| 1094-61-7 | NMN |
| 16940-66-2 | Sodium borohydride |
| 103-90-2 | 4-Acetamido phenol,paracetamol |
| 130-89-2 | Quinine Hydrochloride |
| 23593-75-1 | clotrimazole |
Packing&Shipping:
1-10kgs: packaging Aluminum Foil Bag inside and carton box outside
25kgs: packaging Fiber drum outside and plastic bag inside

Our company:
Wuhan wingroup Pharmaceutical Co.,Ltd., located in Wuhan, Hubei Province, is a company dedicated to R & D,production and sales of chemical reagents, pharmaceutical intermediates, plantextracts and chemical raw materials. The company has a long-term cooperationwith Wuhan Research Institute and other universities. It is a pharmaceuticalenterprise oriented by the global pharmaceutical market demand and integratingthe research and development, industrialization and market operation ofinnovative drugs. At present, the company has submitted 10 domestic patents andone PCT patent (International Patent); And obtained the authorization of 7invention patents. The company has strong technical strength, advanced equipment,strict quality management system and high-quality after-sales service.
Over the years, our products have been widely sold to many countries and regions that we have established stable relations of cooperation with the traders and end users all around the world and have become a solid bridge among the suppliers, traders and end users.

FAQ:
Q1: Can I get a sample?
A:Free samples is available, while the shipping cost should undertake by your side.
Q2: What is your MOQ?
A:Our MOQ is 10g, 100g and 1kg for your evaluation quality of our goods on the condition that sample charge is 100% paid.
Q3: Is there any discount?
A:Yes, for larger quantity, we always support with better price.
Q4: What payment terms do you accept ?
A:We'd like to accept T/T, L/C, Paypal, or Western Union.
Q5: How long will it take to get the good?
A:Depending on your location, For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS. For mass order, please allow 5-8 days by Air, 20-35 days by Sea.