-Product Description-
Our company has a variety of high-quality pharmaceutical intermediates, 100% Quality Guarantee.
If you are interested in us, please feel free to contact me:WhatsApp/Skype/Telegram:+86 15621811730.
Product Name: | Teriparatide acetate |
Synonyms: | PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
CAS: | 52232-67-4 |
MF: | C172H278N52O47S2 |
MW: | 3890.49792 |
EINECS: | 640-978-1 |
Product Categories: | Amino Acid Derivatives;EndocrinologyandHormones;Peptide;Hormones;Other Protein/Peptide Hormones;proteins;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;52232-67-4 |
Mol File: | 52232-67-4.mol |

-Company Introduction-

We are Anhui Zhongda Biotechnology Co., Ltd., mainly engaged in pharmaceutical intermediates and various chemicals. It is one of the most dynamic foreign trade companies in the Chinese market. We have a pharmaceutical raw material production workshop and a reagent research and development center. Now has the most complete production line. In addition, we also have custom synthesis of various organic compounds as supplements. We can synthesize almost any chemical.
We always insist on survival by quality and development by reputation.
If you have any products you need, please feel free to contact me.
Hope to establish relations with you!
-Hot Selling Products-


-Packaging & Shipping-

Shipping method: FedEx, DHL, UPS, TNT, Postal Express.

We have a professional customs clearance team, you don't need to worry about any customs issues.We will be responsible for customs clearance taxes and other issues. Professional transportation, convenient and safe, 100% door-to-door delivery. If anything happens to your package, we promise to reship it for free. Enjoy the second free reissue policy.
Looking forward to cooperating with you, our high-quality products and thoughtful service will definitely make you satisfied!