Usage And Synthesis
Amino acids DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR were used as the immunogen for the DDAH2 antibody.
For western blots: incubate membrane with diluted antibody overnight in 5% w/v milk , 1X TBS, 0.1% Tween-20 at 4��C with gentle shaking.
DDAH2 antibody is an unconjugated rabbit polyclonal antibody to human DDAH2. Validated for ELISA, IF, IHC and WB.
DDAH1 antibody is a PE-conjugated rabbit polyclonal antibody to human DDAH1 (aa20-215). Validated for WB.
DDAH2 antibody is an unconjugated rabbit polyclonal antibody to DDAH2 from human. It is reactive with human, mouse and rat. Validated for IF and WB.
DDAH1 antibody is an FITC-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB.
DDB1 antibody is an HRP-conjugated rabbit polyclonal antibody to human DDB1 (Internal). Validated for WB.
DDAH1 antibody is an HRP-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB.
DDAH1 antibody is an unconjugated mouse polyclonal antibody to human DDAH1. Validated for WB.
DDAH1 antibody is an unconjugated rabbit polyclonal antibody to human DDAH1. Validated for IHC.
DDAH1 antibody is an APC-conjugated rabbit polyclonal antibody to human DDAH1 (aa20-215). Validated for WB.
DDAH1 antibody is a PE-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB.
DDAH2 antibody is an unconjugated rabbit polyclonal antibody to DDAH2 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
DDB1 antibody is an FITC-conjugated rabbit polyclonal antibody to human DDB1 (Internal). Validated for WB.
DDB1 antibody is an unconjugated rabbit polyclonal antibody to DDB1 from human. It is reactive with human, mouse and rat. Validated for IF, IHC, Peptide-ELISA and WB.
DDAH1 antibody is a biotin-conjugated rabbit polyclonal antibody to human DDAH1. Validated for WB.
DDAH1 antibody is an APC, Cy7-conjugated rabbit polyclonal antibody to human DDAH1 (aa20-215). Validated for WB.
PROMPT×
PROMPT
The What'sApp is temporarily not supported in mainland China
The What'sApp is temporarily not supported in mainland China
Cancel
Determine