496823-34-8(LUNASIN)
496823-34-8 Basic informationMore
- Product Name:LUNASIN
- Synonyms: LUNASIN Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD
- CAS:496823-34-8
- MF:
- MW:0
- EINECS:
- Mol File:Mol File
-
Recommend You Select Member Companies
- Company Name:Creative Peptides
- Tel:
- Nationality:United States
- Products Intro:Product Name:Lunasin
Purity:>98% Package:1g; 10g;100g;1kg Remarks:Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog pr - CB Index:56
- Related Information:Catalog(6084)
- Company Name:BOC Sciences
- Tel:+1-631-485-4226
- Nationality:United States
- Products Intro:Product Name:Lunasin
Purity:95% Package:1mg Remarks:BOC Sciences also provides custom synthesis services for Lunasin. - CB Index:58
- Related Information:Catalog(19553)