Basic information Supplier

TIP-39

Basic information Supplier
277302-47-3 Basic informationMore

Browse by Nationality 277302-47-3 Suppliers >Global suppliers

Beijing (8) Shanghai (18) Tianjin (1) Sichuan (1) Guangdong (4) Zhejiang (10) Fujian (3) Hunan (1) Hubei (2) Shanxi (1) Henan (1) Jiangsu (7) Other (1) Member (58) All (58)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:TIP 39, Tuberoinfundibular Neuropeptide;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
    CAS:277302-47-3
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-54306202 13764082696
  • Products Intro:Product Name:TIP-39
    CAS:277302-47-3
    Remarks:332P1505 More...
  • CB Index:64
  • Related Information:Catalog(42958)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:TIP 39
    CAS:277302-47-3
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:TIP 39
    CAS:277302-47-3
    Purity:90%HPLC,95%HPLC,98%HPLC Package:5mg,20mg,100mg,250mg,500mg,1g More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:TIP-39
    CAS:277302-47-3
    Purity:95% Package:1G; 10G; 100G
  • CB Index:58
  • Related Information:Catalog(4809)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:TIP 39, Tuberoinfundibular Neuropeptide
    CAS:277302-47-3
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6958)
  •  
1 2 3 4 5 8