Basic information Supplier

H-CYS-SER-CYS-SER-SER-LEU-MET-ASP-LYS-GLU-CYS-VAL-TYR-PHE-CYS-HIS-LEU-ASP-ILE-ILE-TRP-VAL-ASN-THR-PRO-GLU-HIS-ILE-VAL-PRO-TYR-GLY-LEU-GLY-SER-PRO-SER-ARG-SER-OH

Basic information Supplier
120796-99-8 Basic informationMore

Browse by Nationality 120796-99-8 Suppliers >Global suppliers

Beijing (1) Shanghai (9) Sichuan (2) Guangdong (1) Zhejiang (4) Fujian (1) Shanxi (1) Henan (1) Anhui (1) Jiangsu (8) Hong Kong (1) Member (29) All (30)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Big Endothelin 1 (1-39), porcine;CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS(Disulfidebridge:1-15and3-11)
    CAS:120796-99-8
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Sigma-Aldrich
  • Tel:021-61415566 800-8193336
  • Products Intro:CAS:120796-99-8
  • CB Index:80
  • Related Information:Catalog(51471)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 18751916801
  • Products Intro:Product Name:Big Endothelin -1 (1-39),porcine
    CAS:120796-99-8
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5503)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Big Endothelin 1 (1-39), porcine;CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS(Disulfidebridge:1-15and3-11)
    CAS:120796-99-8
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9962)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:Big Endothelin-1 (porcine)
    CAS:120796-99-8
    Purity:1G; 10G; 100G Remarks:95%
  • CB Index:58
  • Related Information:Catalog(5902)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Big Endothelin-1: 1-39, porcine
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6526)
  •  
1 2 3 4