Basic information Supplier

H-SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (1) Shanghai (7) Zhejiang (7) Fujian (1) Jiangsu (2) Member (18) All (18)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Prolactin Releasing Peptide (1-31), bovine;SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-54306202 13764082696
  • Products Intro:Product Name:Prolactin-Releasing Peptide (1-31) (bovine)
    Remarks:271P01 More...
  • CB Index:64
  • Related Information:Catalog(42982)
  •  
  • Company Name:Beijing Solarbio Science & Tecnology Co., Ltd.
  • Tel:010-50973130 4009686088
  • Products Intro:Product Name:Prolactin-Releasing Peptide (1-31), bovine
  • CB Index:68
  • Related Information:Catalog(29795)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Prolactin-Releasing Peptide (1-31) (bovine)
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6525)
  •  
  • Company Name:Hangzhou Go Top Peptide Biotech
  • Tel:0571-88211921 13355716090
  • Products Intro:Product Name:Prolactin Releasing Peptide (1-31), bovine
    Purity:95%-98% HPLC Package:1mg;10mg;100mg;1g;100g
  • CB Index:58
  • Related Information:Catalog(2841)
  •  
1 2 3