GALANIN (1-13)-SPANTIDE I
143868-20-6 Basic informationMore
- Product Name:GALANIN (1-13)-SPANTIDE I
- Synonyms: GALANIN (1-13)-SPANTIDE AMIDE GALANIN (1-13)-SPANTIDE I galanin fragment 1-13-spantide i Galanin (1-13) - Spantide I amide M.W. 2828.27 C138H199N35O30 GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2: GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 Galanin (1-13)-Spantide I, C8 Galanin (1-13)-Spantide I C7
- CAS:143868-20-6
- MF:C138H199N35O30
- MW:2828.27
- EINECS:
- Mol File:143868-20-6.mol
-
Lastest Price from GALANIN (1-13)-SPANTIDE I manufacturers
Browse by Nationality 143868-20-6 Suppliers >Global suppliers
Beijing (2) Shanghai (12) Sichuan (3) Guangdong (3) Zhejiang (13) Shanxi (1) Henan (1) Liaoning (1) Anhui (2) Jiangsu (13) Shaanxi (1) Hong Kong (1) Other (1) Member (52) All (54)
Please select the suppliers
Recommend You Select Member Companies
Recommend You Select Member Companies
- Company Name:GL Biochem (Shanghai) Ltd
- Tel:21-61263452 13641803416
- Products Intro:Product Name:Galanin (1-13)-Spantide I, C8;GWTLNSAGYLLGPrPKPQQwFwLL-NH2
CAS:143868-20-6
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More... - CB Index:64
- Related Information:Catalog(9981)
- Company Name:Shanghai Hanhong Scientific Co.,Ltd.
- Tel:021-54306202 13764082696
- Products Intro:Product Name:Galanin (1-13)-Spantide I
CAS:143868-20-6
Remarks:136P09 More... - CB Index:64
- Related Information:Catalog(42982)
- Company Name:Cellmano Biotech Limited
- Tel:0551-65326643 18156095617
- Products Intro:Product Name:Galanin (1-13)-Spantide I
C7
CAS:143868-20-6
Purity:98% HPLC Package:5Mg;10Mg;1g More... - CB Index:55
- Related Information:Catalog(1011)
- Company Name:Nanjing Leon Biological Technology Co., Ltd.
- Tel: 18751916801
- Products Intro:Product Name:Galanin (1-13)-spantide amide
CAS:143868-20-6
Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More... - CB Index:55
- Related Information:Catalog(5503)
- Company Name:Nanjing Peptide Biotech Ltd.
- Tel:025-025-58361106-805-805 13082558573
- Products Intro:Product Name:Galanin (1-13)-Spantide I, C8;GWTLNSAGYLLGPrPKPQQwFwLL-NH2
CAS:143868-20-6
Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More... - CB Index:55
- Related Information:Catalog(9962)
- Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
- Tel:0571-87213919
- Products Intro:Product Name:Galanin (1-13)-Spantide I, C8
CAS:143868-20-6
Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement. - CB Index:58
- Related Information:Catalog(6525)