Basic information Supplier

NEUROPEPTIDE K, PORCINE

Basic information Supplier
106441-70-7 Basic informationMore

Browse by Nationality 106441-70-7 Suppliers >Global suppliers

Beijing (2) Shanghai (9) Chongqing (1) Sichuan (1) Guangdong (4) Zhejiang (9) Fujian (2) Hunan (1) Shandong (1) Henan (1) Liaoning (1) Anhui (1) Jiangsu (6) Hong Kong (1) Other (1) Member (39) All (41)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Neuropeptide K, porcine;DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2
    CAS:106441-70-7
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Neuropeptide K, porcine
    CAS:106441-70-7
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Neuropeptide K, porcine;DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2
    CAS:106441-70-7
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:Neuropeptide K, porcine
    CAS:106441-70-7
    Purity:95% Package:1G; 10G; 100G
  • CB Index:58
  • Related Information:Catalog(4806)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Neuropeptide K, porcine
    CAS:106441-70-7
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(7071)
  •  
  • Company Name:Career Henan Chemica Co
  • Tel:+86-0371-86658258 +8613203830695
  • Products Intro:Product Name:NEUROPEPTIDE K, PORCINE
    CAS:106441-70-7
    Purity:99% Package:1KG;7USD
  • CB Index:58
  • Related Information:Catalog(30231)
  •  
1 2 3 4 5