Basic information Supplier

PEPTIDE YY, PORCINE

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (4) Shanghai (16) Jiangsu (4) Hong Kong (1) Member (23) All (25)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Peptide YY, porcine;YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Sigma-Aldrich
  • Tel:021-61415566 800-8193336
  • Products Intro:Product Name:Peptide YY EIA Kit
    Purity:for serum, culture supernatant and cell lysates Package:1KT Remarks:RAB0413-1KT More...
  • CB Index:80
  • Related Information:Catalog(51471)
  •  
  • Company Name:Shanghai Yaji Biological Technology Co., Ltd.
  • Tel:021-34661275 15301693058
  • Products Intro:Product Name:PYY
    Package:1/ RMB 1200
  • CB Index:58
  • Related Information:Catalog(8684)
  •  
  • Company Name:Shanghai Toyang Biotechnology Co., LTD
  • Tel:021-59555769 13524932310
  • Products Intro:Product Name:PYY (porcine, rat)
    Purity:>95% Package:5mg,10mg,50mg,100mg,500mg,1g
  • CB Index:58
  • Related Information:Catalog(8221)
  •  
  • Company Name:Shanghai Zhenyu Biological Technology Co., Ltd.
  • Tel: 15801849740
  • Products Intro:Product Name:Peptide YY porcine
  • CB Index:58
  • Related Information:Catalog(6970)
  •  
  • Company Name:Suzhou Ruinuode Biotechnology Co., Ltd.
  • Tel:0512-83377216 13771841836
  • Products Intro:Product Name:PYY
  • CB Index:58
  • Related Information:Catalog(6063)
  •  
  • Company Name:Rhenbo (Shanghai) Biochemical Technology Co., Ltd.
  • Tel:021-60536361
  • Products Intro:Product Name:Peptide YY porcine
  • CB Index:58
  • Related Information:Catalog(6334)
  •  
1 2 3