Basic information Supplier

HUMAN NEUTROPHIL PEPTIDE-1

Basic information Supplier
99287-08-8 Basic informationMore
Lastest Price from HUMAN NEUTROPHIL PEPTIDE-1 manufacturers

Browse by Nationality 99287-08-8 Suppliers >Global suppliers

Beijing (10) Shanghai (21) Tianjin (1) Sichuan (1) Guangdong (3) Zhejiang (10) Fujian (2) Hunan (1) Hubei (1) Henan (1) Hebei (2) Anhui (1) Jiangsu (9) Member (62) All (63)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:HNP-1, Defensin Human Neutrophil Peptide-1;ACYCRIPACIAGERRYGTCIYQGRLWAFCC(Disulfidebridge:2-30,4-19,9-29)
    CAS:99287-08-8
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Sigma-Aldrich
  • Tel:021-61415566 800-8193336
  • Products Intro:Product Name:Defensin HNP-1 human
    CAS:99287-08-8
    Purity:>=80% (HPLC) Package:25μg Remarks:D2043 More...
  • CB Index:80
  • Related Information:Catalog(51456)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:β-Defensin-1, human
    CAS:99287-08-8
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:HNP-1, Defensin Human Neutrophil Peptide-1;ACYCRIPACIAGERRYGTCIYQGRLWAFCC(Disulfidebridge:2-30,4-19,9-29)
    CAS:99287-08-8
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:α-Defensin-1, human
    CAS:99287-08-8
    Purity:95% Package:1G; 10G; 100G
  • CB Index:58
  • Related Information:Catalog(4809)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Defensin HNP-1 human
    CAS:99287-08-8
    Purity:98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement. Remarks:10mg More...
  • CB Index:58
  • Related Information:Catalog(6968)
  •  
1 2 3 4 5 8