Basic information Supplier

FIBRONECTIN-BINDING PROTEIN PEPTIDE D3

Basic information Supplier
119977-20-7 Basic informationMore
Lastest Price from FIBRONECTIN-BINDING PROTEIN PEPTIDE D3 manufacturers

Browse by Nationality 119977-20-7 Suppliers >Global suppliers

Beijing (2) Shanghai (10) Guangdong (2) Zhejiang (3) Henan (1) Jiangsu (7) Other (1) Member (25) All (26)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Fibronectin Binding Protein Peptide, D3 Peptide;FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
    CAS:119977-20-7
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-021-64543801 13764082696
  • Products Intro:Product Name:Fibronectin-Binding Protein Peptide D3
    CAS:119977-20-7
    Remarks:332P496 More...
  • CB Index:64
  • Related Information:Catalog(42982)
  •  
  • Company Name:Beijing Solarbio Science & Tecnology Co., Ltd.
  • Tel:010-50973130 4009686088
  • Products Intro:Product Name:Fibronectin-Binding Protein
  • CB Index:68
  • Related Information:Catalog(29796)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Fibronectin-Binding Protein
    CAS:119977-20-7
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5503)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Fibronectin Binding Protein Peptide, D3 Peptide;FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
    CAS:119977-20-7
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9962)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Fibronectin Binding Protein Peptide, D3 Peptide
    CAS:119977-20-7
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6347)
  •  
1 2 3 4