Basic information Supplier

FIBRONECTIN-BINDING PROTEIN PEPTIDE D3

Basic information Supplier
119977-20-7 Basic informationMore
Lastest Price from FIBRONECTIN-BINDING PROTEIN PEPTIDE D3 manufacturers

Browse by Nationality 119977-20-7 Suppliers >Global suppliers

Beijing (2) Shanghai (10) Guangdong (3) Zhejiang (3) Henan (1) Jiangsu (7) Shaanxi (1) Other (1) Member (27) All (28)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Fibronectin Binding Protein Peptide, D3 Peptide;FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
    CAS:119977-20-7
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-54306202 13764082696
  • Products Intro:Product Name:Fibronectin-Binding Protein Peptide D3
    CAS:119977-20-7
    Remarks:332P496 More...
  • CB Index:64
  • Related Information:Catalog(42958)
  •  
  • Company Name:Beijing Solarbio Science & Tecnology Co., Ltd.
  • Tel:010-50973130 4009686088
  • Products Intro:Product Name:Fibronectin-Binding Protein
  • CB Index:68
  • Related Information:Catalog(29764)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Fibronectin-Binding Protein
    CAS:119977-20-7
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Fibronectin Binding Protein Peptide, D3 Peptide;FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
    CAS:119977-20-7
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Fibronectin Binding Protein Peptide, D3 Peptide
    CAS:119977-20-7
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6958)
  •  
1 2 3 4