Basic information Supplier

Neuromedin S (human)

Basic information Supplier
1138204-27-9 Basic informationMore

Browse by Nationality 1138204-27-9 Suppliers >Global suppliers

Beijing (2) Shanghai (10) Guangdong (3) Zhejiang (8) Fujian (1) Shanxi (1) Jiangsu (9) Member (34) All (34)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Neuromedin S, human??;ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-54306202 13764082696
  • Products Intro:Product Name:Neuromedin S (human)
    Remarks:332P2392 More...
  • CB Index:64
  • Related Information:Catalog(42982)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Neuromedin S (Human)
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5503)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Neuromedin S (Human)
    Purity:90%HPLC,95%HPLC,98%HPLC Package:5mg,20mg,100mg,250mg,500mg,1g More...
  • CB Index:55
  • Related Information:Catalog(9962)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Neuromedin S (human)
    CAS:1138204-27-9
    Purity:95% or 98% HPLC Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6526)
  •  
1 2 3 4 5