Basic information Supplier

Neuromedin S (human)

Basic information Supplier
1138204-27-9 Basic informationMore

Browse by Nationality 1138204-27-9 Suppliers >Global suppliers

Beijing (2) Shanghai (10) Sichuan (1) Guangdong (3) Zhejiang (8) Fujian (1) Hunan (1) Shanxi (1) Jiangsu (9) Member (36) All (36)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Neuromedin S, human??;ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-54306202 13764082696
  • Products Intro:Product Name:Neuromedin S (human)
    Remarks:332P2392 More...
  • CB Index:64
  • Related Information:Catalog(42958)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Neuromedin S (Human)
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Neuromedin S (Human)
    Purity:90%HPLC,95%HPLC,98%HPLC Package:5mg,20mg,100mg,250mg,500mg,1g More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:Neuromedin S (human)
    CAS:1138204-27-9
    Purity:95% Package:1G; 10G; 100G
  • CB Index:58
  • Related Information:Catalog(4810)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Neuromedin S (human)
    CAS:1138204-27-9
    Purity:95% or 98% HPLC Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6958)
  •  
1 2 3 4 5