Basic information Supplier

GLUCAGON (1-37) (PORCINE)

Basic information Supplier
62340-29-8 Basic informationMore
Lastest Price from GLUCAGON (1-37) (PORCINE) manufacturers
  • Oxyntomodulin
  • US $0.00 /MG
  • CAS:62340-29-8
  • Min. Order: 1MG
  • Purity: 95%
  • Supply Ability: 20 TONS
  • 2024-09-25

Browse by Nationality 62340-29-8 Suppliers >Global suppliers

Shanghai (5) Sichuan (1) Guangdong (1) Zhejiang (11) Fujian (1) Hunan (1) Hubei (5) Shandong (2) Shanxi (1) Henan (1) Jiangsu (6) Jiangxi (1) Member (36) All (36)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:3B Pharmachem (Wuhan) International Co.,Ltd.
  • Tel:821-50328103-801 18930552037
  • Products Intro:Product Name:OxyntoModulin
    CAS:62340-29-8
    Purity:99% HPLC Package:1Mg ; 5Mg;10Mg ;100Mg;250Mg ;500Mg ;1g;2.5g ;5g ;10g More...
  • CB Index:69
  • Related Information:Catalog(15839)
  •  
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Glucagon (1-37), porcine: Oxyntomodulin, porcine;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
    CAS:62340-29-8
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Oxyntomodulin
    CAS:62340-29-8
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Oxyntomodulin
    CAS:62340-29-8
    Purity:90%HPLC,95%HPLC,98%HPLC Package:5mg,20mg,100mg,250mg,500mg,1g More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:Oxyntomodulin(porcine/bovine)
    CAS:62340-29-8
    Purity:95% Package:1G; 10G; 100G
  • CB Index:58
  • Related Information:Catalog(4805)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Oxyntomodulin (porcine, bovine)
    CAS:62340-29-8
    Purity:98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement. Remarks:100mg
  • CB Index:58
  • Related Information:Catalog(7071)
  •  
  • Company Name:Zhejiang J&C Biological Technology Co.,Limited
  • Tel:+1-2135480471 +1-2135480471
  • Products Intro:CAS:62340-29-8
    Purity:99% Package:5KG;1KG
  • CB Index:58
  • Related Information:Catalog(10473)
  •  
1 2 3 4 5