Basic information Supplier

AMYLIN (RAT)

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (9) Shanghai (13) Guangdong (2) Zhejiang (2) Fujian (2) Hubei (1) Anhui (1) Jiangsu (8) Other (1) Member (38) All (39)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Amylin (1-37), rat;KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2(Disulfidebridge:2-7)
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Amylin (Rat)
    Purity:98% HPLC Package:1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Amylin (1-37), rat;KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2(Disulfidebridge:2-7)
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Amylin (1-37), rat
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(7071)
  •  
  • Company Name:Wuxi Helen Biotechnology Co., Ltd.,
  • Tel:0510-85629785 18013409632
  • Products Intro:Product Name:Amylin (1-37), rat
    Purity:95%+ Package:根据客户需求包装
  • CB Index:58
  • Related Information:Catalog(14081)
  •  
1 2 3 4 5