Basic information Supplier

NEUROMEDIN (B-30)

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (1) Shanghai (4) Zhejiang (2) Jiangsu (5) Member (12) All (12)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Neuromedin (B-30);LSWDLPEPRSRAGKIRVHPRGNLWATGHFM-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Neuromedin (B-30)
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Neuromedin (B-30);LSWDLPEPRSRAGKIRVHPRGNLWATGHFM-NH2
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9979)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Neuromedin (B-30)
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6756)
  •  
  • Company Name:Nanjing Yuanpeptide Biotech Co.,Ltd.
  • Tel: 18168071971
  • Products Intro:Product Name:Neuromedin (B-30)
    Purity:95% HPLC 98% HPLC 99% HPLC Package:10mg;20mg;50mg;100mg;1g;5g;20g
  • CB Index:58
  • Related Information:Catalog(2978)
  •  
  • Company Name:Hangzhou Sinoda Pharmaceutical Technology Co. LTD
  • Tel:0571-87213919 17306812703
  • Products Intro:Product Name:Neuromedin (B-30)
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6445)
  •  
1 2