Basic information Supplier

GLUCAGON-LIKE PEPTIDE 1 (7-36)-LYS(BIOTIN), AMIDE, HUMAN

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Shanghai (2) Zhejiang (2) Jiangsu (3) Member (7) All (7)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Glucagon-Like Peptide 1 (7-36)-Lys(Biotin), amide, human;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Glucagon-Like Peptide 1 (7-36)-Lys(Biotin), amide, human
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6756)
  •  
  • Company Name:Wuxi Helen Biotechnology Co., Ltd.,
  • Tel:0510-85629785 18013409632
  • Products Intro:Product Name:Glucagon-Like Peptide 1 (7-36)-Lys(Biotin), amide, human
    Purity:95%+ Package:根据客户需求包装
  • CB Index:58
  • Related Information:Catalog(14081)
  •  
  • Company Name:Hangzhou Sinoda Pharmaceutical Technology Co. LTD
  • Tel:0571-87213919 17306812703
  • Products Intro:Product Name:Glucagon-Like Peptide 1 (7-36)-Lys(Biotin), amide, human
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6445)
  •  
  • Company Name:Shanghai Toyang Biotechnology Co., LTD
  • Tel:021-59555769 13524932310
  • Products Intro:Product Name:Glucagon-Like Peptide 1 (7-36)-Lys(Biotin), amide, human; GLP-1 (7-36)-Lys(Biotin), amide, human; Preproglucagon (78-107)-Lys(Biotin), amide, human
    Purity:>95% Package:5mg;10mg;50mg
  • CB Index:58
  • Related Information:Catalog(8221)
  •