Apelin-36
1107672-29-6 Basic informationMore
Lastest Price from Apelin-36 manufacturers
Browse by Nationality 1107672-29-6 Suppliers >Global suppliers
Beijing (4) Shanghai (9) Sichuan (1) Guangdong (2) Zhejiang (5) Henan (1) Hebei (1) Liaoning (2) Jiangsu (6) Jiangxi (2) Member (33) All (33)
Please select the suppliers
Recommend You Select Member Companies
Recommend You Select Member Companies
- Company Name:Alabiochem Tech.Co., Ltd.
- Tel:0512-58900862 400-0707518
- Products Intro:Product Name:Apelin-36
CAS:1107672-29-6
Purity:>99% HPLC Package:5mg; 25mg; 100mg; 1g; 5g; 25g;100g Remarks:Peptide More... - CB Index:59
- Related Information:Catalog(995)
- Company Name:Nanjing Chemlin Chemical Co., Ltd
- Tel:025-83697070
- Products Intro:Product Name:Apelin-36 (human)
CAS:1107672-29-6
Purity:98% Package:5KG;1KG More... - CB Index:64
- Related Information:Catalog(17988)
- Company Name:Alpha Biopharmaceuticals Co., Ltd
- Tel:+86-411-39042497 +8613921981412
- Products Intro:Product Name:Apelin-36
CAS:1107672-29-6
Purity:>99% HPLC Package:5mg; 25mg; 100mg; 1g; 5g; 25g;100g - CB Index:58
- Related Information:Catalog(886)
- Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
- Tel:0571-87213919
- Products Intro:Product Name:Apelin 36
CAS:1107672-29-6
Purity:95% or 98% Package:1mg；5mg；10mg；50mg；100mg,1g or according to customer's detail requirement. - CB Index:58
- Related Information:Catalog(6347)
- Company Name:Hebei Yanxi Chemical Co., Ltd.
- Tel: +8617531190177
- Products Intro:Product Name:Apelin-36
CAS:1107672-29-6
Purity:0.99 Package:5KG;1KG Remarks:Factory direct sales - CB Index:58
- Related Information:Catalog(5993)
- Company Name:Hangzhou Xinhai Pharmaceutical Technology Co., Ltd.
- Tel:0571-86758863 13867485072
- Products Intro:Product Name:Apelin-36
Purity:95%;98%,99%HPLC Package:1mg;5mg;10mg;50mg;100mg;1g;10g Remarks:LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF - CB Index:58
- Related Information:Catalog(300)