Basic information Supplier

CALCITONIN (PORCINE)

Basic information Supplier
12321-44-7 Basic informationMore
Lastest Price from CALCITONIN (PORCINE) manufacturers
  • CALCITONIN (PORCINE)
  • US $7.00 /KG
  • CAS: 12321-44-7
  • Min. Order: 1KG
  • Purity: 99%
  • Supply Ability: 100kg
  • 2020-02-14

Browse by Nationality 12321-44-7 Suppliers >Global suppliers

Shanghai (7) Sichuan (3) Guangdong (3) Zhejiang (9) Hunan (1) Hubei (1) Shanxi (1) Henan (1) Anhui (2) Jiangsu (11) Shaanxi (2) Hong Kong (1) Member (39) All (42)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Calcitonin, porcine;CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP-NH2(Disulfidebridge:1-7)
    CAS:12321-44-7
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-54306202 13764082696
  • Products Intro:Product Name:Calcitonin (porcine)
    CAS:12321-44-7
    Remarks:74P06 More...
  • CB Index:64
  • Related Information:Catalog(42958)
  •  
  • Company Name:Cellmano Biotech Limited
  • Tel:0551-65326643 18156095617
  • Products Intro:Product Name:Calcitonin (porcine)
    CAS:12321-44-7
    Purity:98% HPLC Package:5Mg;10Mg;1g More...
  • CB Index:55
  • Related Information:Catalog(1011)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Calcitonin, porcine
    CAS:12321-44-7
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Calcitonin, porcine;CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP-NH2(Disulfidebridge:1-7)
    CAS:12321-44-7
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Calcitonin, porcine
    CAS:12321-44-7
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6968)
  •  
1 2 3 4 5