Basic information Supplier

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-ARG-GLN-LEU-ALA-VAL-ARG-ARG-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-NH2

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (2) Shanghai (4) Zhejiang (2) Fujian (1) Jiangsu (5) Member (14) All (14)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat;HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat;HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9962)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6525)
  •  
  • Company Name:Nanjing Yuanpeptide Biotech Co.,Ltd.
  • Tel: 18168071971
  • Products Intro:Product Name:Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
    Purity:95% HPLC 98% HPLC 99% HPLC Package:10mg;20mg;50mg;100mg;1g;5g;20g
  • CB Index:58
  • Related Information:Catalog(2977)
  •  
  • Company Name:Hangzhou Sinoda Pharmaceutical Technology Co. LTD
  • Tel:0571-87213919 17306812703
  • Products Intro:Product Name:[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6213)
  •  
  • Company Name:Shanghai Toyang Biotechnology Co., LTD
  • Tel:021-59555769 13524932310
  • Products Intro:Product Name:Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat
    Purity:>95% Package:5mg,10mg,50mg,100mg,500mg,1g
  • CB Index:58
  • Related Information:Catalog(8221)
  •  
1 2