Basic information Supplier

LEAP-2 (HUMAN)

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (1) Shanghai (2) Guangdong (1) Zhejiang (8) Jiangsu (4) Other (1) Member (17) All (17)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:LEAP-2 (38-77) (Human)??;MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:LEAP-2 (38-77) (Human)
    Purity:95% or 98% HPLC Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6347)
  •  
  • Company Name:Wuxi Helen Biotechnology Co., Ltd.,
  • Tel:0510-85629785 18013409632
  • Products Intro:Product Name:LEAP-2 (38-77) (Human)
    Purity:>=95% Package:10mg;25mg;50mg;100mg;200mg;500mg
  • CB Index:58
  • Related Information:Catalog(14092)
  •  
  • Company Name:Hangzhou Go Top Peptide Biotech
  • Tel:0571-88211921 13355716090
  • Products Intro:Product Name:LEAP-2 (38-77) (Human)
    Purity:95%-98% HPLC Package:1mg;10mg;100mg;1g;100g
  • CB Index:58
  • Related Information:Catalog(2831)
  •  
  • Company Name:Nanjing Yuanpeptide Biotech Co.,Ltd.
  • Tel: 18168071971
  • Products Intro:Product Name:LEAP-2(38-77)(Human)
    Purity:95% HPLC 98% HPLC 99% HPLC Package:10mg;20mg;50mg;100mg;1g;5g;20g
  • CB Index:58
  • Related Information:Catalog(2977)
  •  
1 2 3