Basic information Supplier

CRF (OVINE)

Basic information Supplier
9015-71-8 Basic informationMore

Browse by Nationality 9015-71-8 Suppliers >Global suppliers

Shanghai (20) Sichuan (1) Guangdong (3) Zhejiang (5) Shandong (1) Henan (1) Jiangsu (6) Member (35) All (37)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Corticotropin Releasing Factor, CRF, ovine;SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
    CAS:9015-71-8
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Chengdu HuaXia Chemical Reagent Co. Ltd
  • Tel:400-1166-196 13458535857
  • Products Intro:Product Name:Corticotropin Releasing Factor sheep
    CAS:9015-71-8
    Purity:99% HPLC Package:10g;50g;100g;500g;1kg;5kg;25kg More...
  • CB Index:58
  • Related Information:Catalog(13350)
  •  
  • Company Name:Sigma-Aldrich
  • Tel:021-61415566 800-8193336
  • Products Intro:Product Name:Corticotropin Releasing Factor sheep
    CAS:9015-71-8
    Purity:>= 95 % HPLC Package:250μg, 0.5mg, 1mg Remarks:C3167 More...
  • CB Index:80
  • Related Information:Catalog(51456)
  •  
  • Company Name:Codow Chemical Co.,Ltd.
  • Tel: 18620099427
  • Products Intro:Product Name:Corticotropin Releasing Factor sheep
    CAS:9015-71-8
    Purity:95% (HPLC) Package:1MG;2.5MG;5MG More...
  • CB Index:55
  • Related Information:Catalog(17687)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Corticotropin Releasing Factor, CRF, ovine;SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
    CAS:9015-71-8
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Corticotropin Releasing Factor sheep
    CAS:9015-71-8
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6958)
  •  
1 2 3 4 5