114547-31-8(GALANIN, RAT)
114547-31-8 Basic informationMore
- Product Name:GALANIN, RAT
- Synonyms: GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2 H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2 GALANIN, RAT Galanin (mouse, rat) GALANIN RATGALANIN Rat galanin-(1-29) L-Threoninamide,glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-leucyl-L-leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-a-aspartyl-L-asparaginyl-L-histidyl-L-arginyl-L-seryl-L-phenylalanyl-L-seryl-L-a-aspa
- CAS:114547-31-8
- MF:C141H211N43O41
- MW:3164.45
- EINECS:
- Mol File:114547-31-8.mol
-
Browse by Nationality 114547-31-8 Suppliers >China suppliers
France (1) Germany (2) Japan (1) Switzerland (1) United Kingdom (3) United States (15) Member (8) All (23)
Recommend You Select Member Companies
- Company Name:Creative Peptides
- Tel:
- Nationality:United States
- Products Intro:Product Name:Galanin (mouse, rat)
CAS:114547-31-8
Purity:>98% Package:1g; 10g;100g;1kg Remarks:Various Products/Alzheimer's Disease - CB Index:56
- Related Information:Catalog(6083)
- Company Name:BOC Sciences
- Tel:
- Nationality:USA
- Products Intro:Product Name:Galanin (1-29) (rat, mouse)
CAS:114547-31-8
Remarks:Galanin (1-29) (rat, mouse) is a non-selective galanin receptor agonist (Ki = 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3, respectively) with anticonvulsant activity. - CB Index:65
- Related Information:Catalog(0)
- Company Name:BOC Sciences
- Tel:+1-631-485-4226
- Nationality:United States
- Products Intro:Product Name:Galanin (1-29) (rat, Mouse)
CAS:114547-31-8
Remarks:Reach out to us for more information about custom solutions. - CB Index:58
- Related Information:Catalog(19552)
- Company Name:ApexBio Technology
- Tel:+ 1-832-696-8203
- Nationality:United States
- Products Intro:Product Name:Galanin (1-29) (rat, mouse)
CAS:114547-31-8 - CB Index:58
- Related Information:Catalog(6251)
- Company Name:United States Biological
- Tel:1-800-520-3011
- Nationality:United States
- Products Intro:Product Name:Galanin (rat)
- CB Index:58
- Related Information:Catalog(6075)