Basic information Supplier

(AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE)

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >China suppliers

United States (3) Member (3) All (3)
Recommend You Select Member Companies
  • Company Name:Creative Peptides
  • Tel:
  • Nationality:United States
  • Products Intro:Product Name:Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
    Purity:>98% Package:1g; 10g;100g;1kg Remarks:This is a membrane-permeable phosphoducin-like anti-βγ peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to conf
  • CB Index:56
  • Related Information:Catalog(6083)
  •  
  • Company Name:BOC Sciences
  • Tel:16314854226; +16314854226
  • Nationality:United States
  • Products Intro:Product Name:Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
    Purity:>=95% Remarks:BOC Sciences also provides custom synthesis services for Anti-BetaGamma (MPS-Phosducin-like protein C terminus).
  • CB Index:58
  • Related Information:Catalog(19741)
  •  
  • Company Name:AnaSpec, Inc.
  • Tel:800 452 5530
  • Nationality:United States
  • Products Intro:
  • CB Index:77
  • Related Information:Catalog(4871)
  •