154947-66-7(LL-37)
154947-66-7 Basic informationMore
- Product Name:LL-37
- Synonyms: Antibacterial Protein LL-37 (huMan), LL37, CAMP H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH Antibacterial Protein LL-37 (human) LL-37 (trifluoroacetate salt) [LL-37, 37 aa] Cathelicidin LL 37 (human) LL-37, LL37, CAMP LL-37 human acetate
- CAS:154947-66-7
- MF:C205H340N60O53
- MW:0
- EINECS:211-519-9
- Mol File:Mol File
-
Browse by Nationality 154947-66-7 Suppliers >China suppliers
United Kingdom (1) United States (7) Member (8) All (8)
Recommend You Select Member Companies
- Company Name:Creative Peptides
- Tel:
- Nationality:United States
- Products Intro:Product Name:LL-37, Human
CAS:154947-66-7
Purity:>98% Package:1g; 10g;100g;1kg Remarks:Peptide Inhibitors - CB Index:56
- Related Information:Catalog(6083)
- Company Name:BOC Sciences
- Tel:
- Nationality:USA
- Products Intro:Product Name:LL-37
CAS:154947-66-7
Purity:98% Remarks:LL-37 is a cationic and α-helical antimicrobial peptide. It can inhibit growth of Gram-positive E. coli D21 and Gram-negative B. megatarium in a concentration-dependent manner. LL-37 can promote wound - CB Index:65
- Related Information:Catalog(0)
- Company Name:BOC Sciences
- Tel:+1-631-485-4226
- Nationality:United States
- Products Intro:Product Name:LL-37, Human
CAS:154947-66-7
Purity:98% Package:1mg Remarks:BOC Sciences also provides custom synthesis services for LL-37, Human. - CB Index:58
- Related Information:Catalog(19552)
- Company Name:Aladdin Scientific
- Tel:
- Nationality:United States
- Products Intro:Product Name:LL-37 acetate
CAS:154947-66-7
Purity:98% Package:$299.9/1mg;$1346.9/5mg;$2423.9/10mg;$5453.9/25mg;$9816.9/50mg;Bulk package Remarks:98% - CB Index:58
- Related Information:Catalog(57505)
- Company Name:ApexBio Technology
- Tel:+ 1-832-696-8203
- Nationality:United States
- Products Intro:Product Name:LL 37
CAS:154947-66-7 - CB Index:58
- Related Information:Catalog(6251)