Basic information Supplier

ADRENOMEDULLIN (26-52) (HUMAN)

Basic information Supplier
192871-80-0 Basic informationMore
Lastest Price from ADRENOMEDULLIN (26-52) (HUMAN) manufacturers

Browse by Nationality 192871-80-0 Suppliers >Global suppliers

Beijing (2) Shanghai (10) Sichuan (1) Guangdong (2) Zhejiang (9) Fujian (1) Hunan (1) Shandong (1) Shanxi (1) Jiangsu (9) Other (1) Member (38) All (38)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Adrenomedullin (26-52), human;LAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-54306202 13764082696
  • Products Intro:Product Name:Adrenomedullin (26-52) (human)
    Remarks:5P07 More...
  • CB Index:64
  • Related Information:Catalog(42958)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Adrenomedullin (26-52)(Human)
    Purity:98% HPLC Package:1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Adrenomedullin (26-52), human;LAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:Adrenomedullin (26-52) (human)
    CAS:192871-80-0
    Purity:95% Package:1G; 10G; 100G More...
  • CB Index:58
  • Related Information:Catalog(4816)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Adrenomedullin (26-52) (human)
    CAS:192871-80-0
    Purity:95% or 98% HPLC Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6968)
  •  
1 2 3 4 5