Basic information Supplier

NEUROPEPTIDE Y (HUMAN, RAT)

Basic information Supplier
99575-89-0 Basic informationMore
Lastest Price from NEUROPEPTIDE Y (HUMAN, RAT) manufacturers

Browse by Nationality 99575-89-0 Suppliers >Global suppliers

Beijing (3) Shanghai (10) Sichuan (4) Guangdong (2) Zhejiang (6) Hunan (1) Shanxi (1) Henan (1) Hebei (1) Liaoning (1) Anhui (2) Jiangsu (9) Other (1) Member (41) All (42)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Neuropeptide Y, human, rat;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
    CAS:99575-89-0
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-54306202 13764082696
  • Products Intro:Product Name:Neuropeptide Y (free acid) (human, rat)
    CAS:99575-89-0
    Remarks:229P03 More...
  • CB Index:64
  • Related Information:Catalog(42957)
  •  
  • Company Name:Cellmano Biotech Limited
  • Tel:0551-65326643 18156095617
  • Products Intro:Product Name:Neuropeptide Y (free acid) (huMan, rat) NPY (free acid) (huMan, rat)
    CAS:99575-89-0
    Purity:98% HPLC Package:5Mg;10Mg;1g More...
  • CB Index:55
  • Related Information:Catalog(1011)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:Neuropeptide Y, human; [D-Trp34]-NPY, human-[D-Trp34]
    CAS:99575-89-0
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Neuropeptide Y, human; [D-Trp34]-NPY, human-[D-Trp34]
    CAS:99575-89-0
    Purity:90%HPLC,95%HPLC,98%HPLC Package:5mg,20mg,100mg,250mg,500mg,1g More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:Neuropeptide Y (free acid) (human, rat)
    CAS:99575-89-0
    Purity:企业级 Package:95%
  • CB Index:58
  • Related Information:Catalog(4803)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Neuropeptide Y (free acid) (human, rat)
    CAS:99575-89-0
    Purity:98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement. Remarks:1g
  • CB Index:58
  • Related Information:Catalog(7061)
  •  
1 2 3 4 5 6