Basic information Supplier

(AC-TYR1,D-PHE2)-GRF (1-29) AMIDE (HUMAN)

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (1) Shanghai (7) Zhejiang (2) Jiangsu (3) Member (13) All (13)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:3B Pharmachem (Wuhan) International Co.,Ltd.
  • Tel:821-50328103-801 18930552037
  • Products Intro:Product Name:[Ac-Tyr1,D-Phe2]GRF 1-29, aMide (huMan)
    Purity:99% HPLC Package:1Mg ; 5Mg;10Mg ;100Mg;250Mg ;500Mg ;1g;2.5g ;5g ;10g More...
  • CB Index:69
  • Related Information:Catalog(15848)
  •  
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:VIP Antagonist;KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:VIP Antagonist;KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9978)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Ac-Tyr1,D-Phe2]GRF 1-29, amide (human); VIP Antagonist
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6757)
  •  
  • Company Name:Hangzhou Sinoda Pharmaceutical Technology Co. LTD
  • Tel:0571-87213919 17306812703
  • Products Intro:Product Name:[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human); VIP Antagonist
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6445)
  •  
1 2