Basic information Supplier

(D-ALA2)-GRF (1-29) AMIDE (HUMAN)

Basic information Supplier
89453-59-8 Basic informationMore
Lastest Price from (D-ALA2)-GRF (1-29) AMIDE (HUMAN) manufacturers

Browse by Nationality 89453-59-8 Suppliers >Global suppliers

Shanghai (6) Sichuan (3) Zhejiang (4) Fujian (1) Shanxi (1) Henan (1) Liaoning (1) Anhui (2) Jiangsu (5) Member (24) All (24)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Growth Hormone Releasing Factor, GRF (1-29), amide, human;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
    CAS:89453-59-8
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Shanghai Hanhong Scientific Co.,Ltd.
  • Tel:021-54306202 13764082696
  • Products Intro:Product Name:(D-Ala2)-GRF (1-29) amide (human)
    CAS:89453-59-8
    Remarks:157P04 More...
  • CB Index:64
  • Related Information:Catalog(42958)
  •  
  • Company Name:Cellmano Biotech Limited
  • Tel:0551-65326643 18156095617
  • Products Intro:Product Name:(D-Ala2)-GRF (1-29) aMide (huMan) (D-Ala2)-SerMorelin
    CAS:89453-59-8
    Purity:98% HPLC Package:5Mg;10Mg;1g More...
  • CB Index:55
  • Related Information:Catalog(1011)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:(D-Ala2)-Sermorelin
    CAS:89453-59-8
    Purity:98% HPLC Package:5mg;1G;10G;100G;1KG More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:Growth Hormone Releasing Factor, GRF (1-29), amide, human;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
    CAS:89453-59-8
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Growth Hormone Releasing Factor, GRF (1-29), amide, human
    CAS:89453-59-8
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6968)
  •  
1 2 3