(D-Ala2)-Gastric Inhibitory Polypeptide (human)
444073-04-5 Basic informationMore
- Product Name:(D-Ala2)-Gastric Inhibitory Polypeptide (human)
- Synonyms: (D-Ala2)-Gastric Inhibitory Polypeptide (human) [D-Ala2]-GIP (human) (D-Ala?)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt Y(D-A)EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (D-Ala2)-Gastric Inhibitory Polypeptide (human) TFA
- CAS:444073-04-5
- MF:C22H27NO11
- MW:481.44988
- EINECS:
- Mol File:444073-04-5.mol
-
Browse by Nationality 444073-04-5 Suppliers >Global suppliers
Shanghai (4) Sichuan (1) Guangdong (1) Zhejiang (8) Shanxi (1) Henan (1) Jiangsu (3) Member (19) All (19)
Please select the suppliers
Recommend You Select Member Companies
Recommend You Select Member Companies
- Company Name:Chengdu Youngshe Chemical Co., Ltd.
- Tel:+86-17380623303 +86-17380623303
- Products Intro:Product Name:D-Ala2]-GIP (human)
CAS:444073-04-5
Purity:95% Package:1G; 10G; 100G - CB Index:58
- Related Information:Catalog(5392)
- Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
- Tel:0571-87213919
- Products Intro:Product Name:[D-Ala2]-GIP (human)
CAS:444073-04-5
Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement. - CB Index:58
- Related Information:Catalog(6526)
- Company Name:Nanjing TGpeptide Biotechnology Co.,Ltd.
- Tel: 18115476705
- Products Intro:Product Name:(D-Ala2)-Gastric Inhibitory Polypeptide (human)
CAS:444073-04-5
Purity:95% HPLC Package:5mg;25mg;100mg;1g - CB Index:58
- Related Information:Catalog(3189)
- Company Name:Hangzhou Go Top Peptide Biotech
- Tel:0571-88211921 13355716090
- Products Intro:Product Name:D-Ala2]-GIP (human)
CAS:444073-04-5
Purity:98% HPLC Package:1mg;10mg;100mg;1g;100g - CB Index:58
- Related Information:Catalog(2842)
- Company Name:Shaoxing Junyu Biotechnology Co., LTD
- Tel:0571-88211921 15572296305
- Products Intro:Product Name:D-Ala2]-GIP (human)
CAS:444073-04-5
Purity:99.99% Package:1mg;10mg;100mg - CB Index:58
- Related Information:Catalog(5144)
- Company Name:Hangzhou Sinoda Pharmaceutical Technology Co. LTD
- Tel:0571-87213919 17306812703
- Products Intro:Product Name:[D-Ala2]-GIP (human)
CAS:444073-04-5
Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement. - CB Index:58
- Related Information:Catalog(6213)
- Company Name:Shanghai HongTide Biotechnology Co.,Ltd.
- Tel: 19961912513
- Products Intro:Product Name:D-Ala2]-GIP (human)
CAS:444073-04-5
Purity:99% HPLC MS Package:1mg;5mg;10mg;100mg;500mg;1kg;5kg;25kg - CB Index:58
- Related Information:Catalog(4665)