Basic information Supplier

PEP-1

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (8) Shanghai (13) Chongqing (1) Sichuan (1) Guangdong (3) Zhejiang (8) Fujian (2) Hunan (1) Hubei (2) Anhui (1) Jiangsu (5) Other (2) Member (46) All (47)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:PEP1;SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:Pep-1
    Purity:95% Package:1G; 10G; 100G
  • CB Index:58
  • Related Information:Catalog(4810)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:PEP1
    Purity:95% or 98% HPLC Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6958)
  •  
  • Company Name:Hangzhou Go Top Peptide Biotech
  • Tel:0571-88211921 13735575465
  • Products Intro:Product Name:Pep-1
    Purity:95%-98% HPLC Package:1mg;10mg;100mg;1g;100g
  • CB Index:58
  • Related Information:Catalog(2891)
  •  
  • Company Name:Shaoxing Junyu Biotechnology Co., LTD
  • Tel:0571-88211921 15572296305
  • Products Intro:Product Name:Pep-1
    Purity:99% HPLC MS Package:1mg;5mg;10mg;100mg;500mg;1kg;5kg;25kg
  • CB Index:58
  • Related Information:Catalog(5178)
  •  
1 2 3 4 5 6