Basic information Supplier

FAEPLPSEEEGESYSKEVPEMEKRYGGFMRF

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (1) Shanghai (5) Sichuan (1) Guangdong (1) Zhejiang (8) Fujian (1) Jiangsu (6) Member (22) All (23)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Peptide B, bovine
    Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:Peptide B, bovine
    Purity:95% Package:1G; 10G; 100G
  • CB Index:58
  • Related Information:Catalog(4881)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Peptide B, bovine
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6757)
  •  
  • Company Name:Hangzhou Go Top Peptide Biotech
  • Tel:0571-88211921 13355716090
  • Products Intro:Product Name:Peptide B, bovine
    Purity:95%-98% HPLC Package:1mg;10mg;100mg;1g;100g
  • CB Index:58
  • Related Information:Catalog(2850)
  •  
  • Company Name:Nanjing Yuanpeptide Biotech Co.,Ltd.
  • Tel: 18168071971
  • Products Intro:Product Name:PeptideB,bovine
    Purity:95% HPLC 98% HPLC 99% HPLC Package:10mg;20mg;50mg;100mg;1g;5g;20g
  • CB Index:58
  • Related Information:Catalog(2977)
  •  
1 2 3