Basic information Supplier

ω-Agatoxin TK

Basic information Supplier
158484-42-5 Basic informationMore

Browse by Nationality 158484-42-5 Suppliers >Global suppliers

Shanghai (6) Tianjin (1) Guangdong (1) Zhejiang (9) Hunan (1) Shanxi (1) Henan (1) Anhui (1) Jiangsu (6) Member (27) All (27)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:3B Pharmachem (Wuhan) International Co.,Ltd.
  • Tel:821-50328103-801 18930552037
  • Products Intro:Product Name:ω-Agatoxin TK
    CAS:158484-42-5
    Purity:99% HPLC Package:1Mg ; 5Mg;10Mg ;100Mg;250Mg ;500Mg ;1g;2.5g ;5g ;10g More...
  • CB Index:69
  • Related Information:Catalog(15839)
  •  
  • Company Name:Sigma-Aldrich
  • Tel:021-61415566 800-8193336
  • Products Intro:Product Name:omega-Agatoxin TK
    CAS:158484-42-5
    Purity:~98% (HPLC), powder Package:.1MG Remarks:A2202-.1MG
  • CB Index:80
  • Related Information:Catalog(51456)
  •  
  • Company Name:Nanjing Leon Biological Technology Co., Ltd.
  • Tel: 17705183659
  • Products Intro:Product Name:ω-Agatoxin TK
    CAS:158484-42-5
    Remarks:EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA (Modifications: Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34) More...
  • CB Index:55
  • Related Information:Catalog(5501)
  •  
  • Company Name:Nanjing Peptide Biotech Ltd.
  • Tel:025-025-58361106-805-805 13082558573
  • Products Intro:Product Name:ω-Agatoxin TK
    CAS:158484-42-5
    Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More...
  • CB Index:55
  • Related Information:Catalog(9980)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:ω-Agatoxin TK
    CAS:158484-42-5
    Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6968)
  •  
  • Company Name:Career Henan Chemica Co
  • Tel:+86-0371-86658258 +8613203830695
  • Products Intro:Product Name:ω-Agatoxin TK
    CAS:158484-42-5
    Purity:99% Package:1KG;7USD
  • CB Index:58
  • Related Information:Catalog(30237)
  •  
  • Company Name:Hangzhou Go Top Peptide Biotech
  • Tel:0571-88211921 13735575465
  • Products Intro:Product Name:Agitoxin-2
    CAS:158484-42-5
    Purity:95%-98% HPLC Package:1mg;10mg;100mg;1g;100g
  • CB Index:58
  • Related Information:Catalog(2890)
  •  
1 2 3 4