Basic information Supplier

LYTIC PEPTIDE SHIVA-1

Basic information Supplier
Basic informationMore

Browse by Nationality Suppliers >Global suppliers

Beijing (4) Shanghai (5) Sichuan (1) Guangdong (3) Zhejiang (8) Fujian (2) Hunan (1) Hubei (1) Jiangsu (3) Hong Kong (1) Other (1) Member (29) All (30)
Please select the suppliers
Recommend You Select Member Companies
  • Company Name:GL Biochem (Shanghai) Ltd
  • Tel:21-61263452 13641803416
  • Products Intro:Product Name:Lytic Peptide, Shiva-1;MPRLFRRIDRVGKQGILRAGPAIALVGDARAVG
    Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More...
  • CB Index:64
  • Related Information:Catalog(9981)
  •  
  • Company Name:Chengdu Youngshe Chemical Co., Ltd.
  • Tel:+86-17380623303 +86-17380623303
  • Products Intro:Product Name:Lytic Peptide, SB-37
    Purity:95% Package:1G; 10G; 100G
  • CB Index:58
  • Related Information:Catalog(4840)
  •  
  • Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
  • Tel:0571-87213919
  • Products Intro:Product Name:Lytic Peptide, Shiva-1
    Purity:95% or 98% HPLC Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6756)
  •  
  • Company Name:Hangzhou Go Top Peptide Biotech
  • Tel:0571-88211921 13355716090
  • Products Intro:Product Name:Lytic Peptide, SB-37
    Purity:95%-98% HPLC Package:1mg;10mg;100mg;1g;100g
  • CB Index:58
  • Related Information:Catalog(2859)
  •  
  • Company Name:Shaoxing Junyu Biotechnology Co., LTD
  • Tel:0571-88211921 15572296305
  • Products Intro:Product Name:Lytic Peptide, SB-37
    Purity:99% HPLC MS Package:1mg;5mg;10mg;100mg;500mg;1kg;5kg;25kg
  • CB Index:58
  • Related Information:Catalog(5128)
  •  
  • Company Name:Hangzhou Sinoda Pharmaceutical Technology Co. LTD
  • Tel:0571-87213919 17306812703
  • Products Intro:Product Name:Lytic Peptide, Shiva-1
    Purity:95% or 98% HPLC Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.
  • CB Index:58
  • Related Information:Catalog(6445)
  •  
1 2 3 4