GIP (3 - 42), human
1802086-25-4 Basic informationMore
- Product Name:GIP (3 - 42), human
- Synonyms: GIP (3 - 42), human GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH GIP (3-42), human - 1 mg
- CAS:1802086-25-4
- MF:
- MW:0
- EINECS:
- Mol File:Mol File
-
Browse by Nationality 1802086-25-4 Suppliers >Global suppliers
Beijing (4) Shanghai (10) Tianjin (1) Sichuan (2) Guangdong (2) Zhejiang (8) Hunan (1) Shanxi (1) Jiangsu (10) Hong Kong (1) Other (1) Member (41) All (41)
Please select the suppliers
Recommend You Select Member Companies
Recommend You Select Member Companies
- Company Name:GL Biochem (Shanghai) Ltd
- Tel:21-61263452 13641803416
- Products Intro:Product Name:GIP (3-42), human;H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g More... - CB Index:64
- Related Information:Catalog(9981)
- Company Name:Shanghai Chaolan Chemical Technology Center
- Tel:021-QQ:65489617 15618227136
- Products Intro:Product Name:GIP (3 - 42), human
CAS:1802086-25-4
Purity:98% Package:50MG;100MG,1G,5G,100G - CB Index:58
- Related Information:Catalog(9189)
- Company Name:Nanjing Peptide Biotech Ltd.
- Tel:025-025-58361106-805-805 13082558573
- Products Intro:Product Name:GIP (3-42), human;H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More... - CB Index:55
- Related Information:Catalog(9980)
- Company Name:Chengdu Youngshe Chemical Co., Ltd.
- Tel:+86-17380623303 +86-17380623303
- Products Intro:Product Name:GIP (3-42), human
CAS:1802086-25-4
Purity:95% Package:1G; 10G; 100G - CB Index:58
- Related Information:Catalog(4803)
- Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
- Tel:0571-87213919
- Products Intro:Product Name:GIP (3-42), human
CAS:1802086-25-4
Purity:95% or 98% HPLC Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement. - CB Index:58
- Related Information:Catalog(7071)
- Company Name:Zhejiang J&C Biological Technology Co.,Limited
- Tel:+1-2135480471 +1-2135480471
- Products Intro:CAS:1802086-25-4
Purity:99% Package:5KG;1KG - CB Index:58
- Related Information:Catalog(10473)